PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp4g28570
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family ARF
Protein Properties Length: 601aa    MW: 67463.3 Da    PI: 6.5953
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp4g28570genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B372.84.3e-23124224198
                EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
         B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                f+k+lt sd++++g +++ +k+a+e+     + +++ +++l+ +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD +vF +   +++ l+v+
  Tp4g28570 124 FVKILTASDTSTHGGFSVLRKHATEClpsldMTQPTPTQELVARDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDAFVFLR--GQTGDLRVG 221
                89****************************9666677789************************************************3..378888**9 PP

                EE- CS
         B3  96 vfr 98 
                v+r
  Tp4g28570 222 VRR 224
                998 PP

2Auxin_resp92.95.2e-31250329183
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                 a+ha++tk+ F  +Y+Pr   s+F++ v+k+++a+k+ +s+G Rf+m+fe+e+s+er ++Gt+vg  dl+p +Wp SkWrsL+
   Tp4g28570 250 ASHAVNTKTLFVLFYKPRI--SQFIIGVNKYMAAMKNGFSIGRRFRMRFEGEESPERIFTGTIVGSGDLSP-QWPASKWRSLQ 329
                 789***************8..9*************************************************.*********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.44E-38109253IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.8E-37119239IPR015300DNA-binding pseudobarrel domain
CDDcd100179.31E-20123224No hitNo description
SMARTSM010192.4E-21124226IPR003340B3 DNA binding domain
PfamPF023623.2E-21124224IPR003340B3 DNA binding domain
PROSITE profilePS5086312.026124226IPR003340B3 DNA binding domain
PfamPF065076.2E-28250329IPR010525Auxin response factor
PfamPF023092.4E-14475574IPR033389AUX/IAA domain
SuperFamilySSF542774.02E-14486566No hitNo description
PROSITE profilePS5174528.712490571IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 601 aa     Download sequence    Send to blast
MANVDDDFRR SGSYDDQLYT ELWKACAGPL VEVPRYGERV FYFPQGHMEQ LVASTNQGVV  60
DQEIPVFNLP SKILCRVLSV MLKAEHETDE IYAQVTLQPE EDQSEPTSLD PPLTEPTKET  120
VDSFVKILTA SDTSTHGGFS VLRKHATECL PSLDMTQPTP TQELVARDLH GYEWRFKHIF  180
RGQPRRHLLT TGWSTFVTSK RLVAGDAFVF LRGQTGDLRV GVRRLAKQQN TMPASVISSQ  240
SMRLGVLATA SHAVNTKTLF VLFYKPRISQ FIIGVNKYMA AMKNGFSIGR RFRMRFEGEE  300
SPERIFTGTI VGSGDLSPQW PASKWRSLQI QWDEPSSVQR PNRVSPWEIE PFSQSTLIPT  360
PTQPHSKSKR SRPIDSSMSE IVGSPVASNF LSSFPQSHEP NPSLKLLFQD PSSERNSNKA  420
GFSSGLQSQK TETPATSCCR LFGFDLKSKP ALAAIPPDKQ LISVDSNNPG STKCQDPNSS  480
KDQKQQTSTR SRTKVQMEGT AVGRAVDLTL LRSYDELISE LEKMFEIEGE LRPKDKWAIV  540
FTDDEGDMML VGDDPWNEFC KMAKKLFIHS SDEVKKMSSK SLFDDEGTIV NLEPEERTVN  600
L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1651235513361Auxin response factor 1
4ldw_A1e-1651235513361Auxin response factor 1
4ldw_B1e-1651235513361Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006397845.10.0hypothetical protein EUTSA_v10001365mg
SwissprotQ9ZPY60.0ARFK_ARATH; Auxin response factor 11
TrEMBLV4LHN40.0V4LHN4_EUTSA; Auxin response factor
STRINGscaffold_403621.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM74351841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46530.10.0auxin response factor 11